DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and serpinb1l2

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:317 Identity:68/317 - (21%)
Similarity:127/317 - (40%) Gaps:62/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLN--QEEIISLFK 84
            |.::|.:.||......|..:||::|..||.::||.....|..::|..|..:.::  .....:|..
Zfish    11 FALDLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSDFHAHFKTLIS 75

  Fly    85 EAREKVAQEQFTMGNRIYLSPDYNASPNITQLSENL-GVEVKNMTFSGDQSAASEIKKWLNKWIG 148
            ......|.....:.||:|....::..|.....:..| ..|.:.:.|.   .||.:.::::|||:.
Zfish    76 SINSPSASYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDFI---RAADDSRQFINKWVE 137

  Fly   149 KAGGN----LFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNR--TFTLLRQNKKPFVYTTQMM 207
            |...|    |.....:::.|:::.|..:.:...|.:...|...:  .|.:.:...:|    .|||
Zfish   138 KQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNESRP----VQMM 198

  Fly   208 YTEAPMDFFNNDQVRG-------------VMVPFKNSDMGMLVLLPRPRYSTQQILYSLDTILKI 259
                       |||..             :.:|:...::.||:|||      .:|.|..|.:||:
Zfish   199 -----------DQVENFPYRCIPEYKLQVLELPYTQQELSMLILLP------DEIKYGSDPLLKL 246

  Fly   260 ----------------KLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNA 300
                            |:...:|..:.|||||:.....|:..|:.:|:.::|..|.|
Zfish   247 ESELNLQKLLDWTSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQETKA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 68/317 (21%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 68/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.