DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SERPINE2

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:389 Identity:93/389 - (23%)
Similarity:160/389 - (41%) Gaps:80/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKE 85
            |..|.:..|:.|.|...|.|.||..|...||:|.|..|..|.:||...::. |:|  .:..:.|:
Human    45 NTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKKQLAMVMRY-GVN--GVGKILKK 106

  Fly    86 AREKVAQEQ----FTMGNRIYLSPDYNAS----PNITQLSENLGVEVKNMTFSGDQSAASEIKKW 142
            ..:.:..::    .|:.|.:::.   |||    |.:|:..:....||:|:.|....||...|..|
Human   107 INKAIVSKKNKDIVTVANAVFVK---NASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAW 168

  Fly   143 LNKWIGKAGGNLFGKNDISQT-TQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFV----- 201
            :.........||...:.|... |::|.|..:.:..:||:|        |......|:.||     
Human   169 VKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSR--------FQPENTKKRTFVAADGK 225

  Fly   202 -YTTQMM---------YTEAPMDFFNNDQVRGVMVPFKNSDMGMLVLLPR----------PRYST 246
             |...|:         .|.||.|.:.|    .:.:|:....:.||:.||.          |..||
Human   226 SYQVPMLAQLSVFRCGSTSAPNDLWYN----FIELPYHGESISMLIALPTESSTPLSAIIPHIST 286

  Fly   247 QQILYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQY--NSF 309
            :    ::|:.:.|.:  .|:..:.||||......||...||.|||.::| :::.|||.:.  .|.
Human   287 K----TIDSWMSIMV--PKRVQVILPKFTAVAQTDLKEPLKVLGITDMF-DSSKANFAKITTGSE 344

  Fly   310 DADQNRVLM--TIDVGDDFDDRVV---------------YVNRGFVFVVKDKST--IYMIGRMD 354
            :...:.:|.  .|:|.:|......               .|:|.|:|.::...|  :..:|:::
Human   345 NLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQIN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 93/386 (24%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.