DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn42Da

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:135/291 - (46%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKEA 86
            |.||:..:||..:...|.|:||.:|:....:..|..:|.|..||:..|.|...:.|:|...|.:.
  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQV 112

  Fly    87 REKVAQEQ-FTMGNRIYLSPDYNASPNITQ-LSENLGVEVKNMTFSGDQSAASEIKKWLNKWIGK 149
            .......| ..:.|:|::...|.......| ||:......:::.||.:..||:.|..|:.:....
  Fly   113 LAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNH 177

  Fly   150 AGGNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNR--TFTL--LRQNKKPFV-YTTQMMYT 209
            ...:|...:.::..:::|.|..:.:...|:::......|  ||.|  .|..:.|.: ...:..|.
  Fly   178 LIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYA 242

  Fly   210 EAP-MDFFNNDQVRGVMVPFKNSDMGMLVLLPRPRYSTQQILYSLDTILKI----KLRRS---KK 266
            :.| :|      ...:.:|:|:||:.||::||    :|:..|.:|:..|::    ::.:|   .|
  Fly   243 DLPALD------AMALELPYKDSDLSMLIVLP----NTKTGLPALEEKLRLTTLSQITQSLYETK 297

  Fly   267 THLFLPKFKVSESVDLNMALKALGIQNLFTN 297
            ..|.||:||....|:|:...:.||:..:|::
  Fly   298 VALKLPRFKAEFQVELSEVFQKLGMSRMFSD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 70/291 (24%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 70/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.