DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn88Ea

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:399 Identity:92/399 - (23%)
Similarity:167/399 - (41%) Gaps:103/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEII-SLF- 83
            ||.:::...:.:.....|..:||.:...||.|.|......|:::|...|.|...:.:|:: |.: 
  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYI 106

  Fly    84 ------KEAREKVAQEQFTMGNRIYLSPDYNASPNITQLSEN-LGVEVKNMTFSGDQSAASEIKK 141
                  ||.:.|:..| |:..:||:.:.|.    ::|:.:.| |..||:.:.|   :|...|.:|
  Fly   107 LEKMNRKERQSKMPLE-FSSADRIFFANDL----HVTECARNRLAEEVQQIDF---KSQTEESRK 163

  Fly   142 WLNKWIGKAG----GNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFVY 202
            .:|.||.|..    .|:...::|:..|::|..........|.::  ..|.:|..:      || |
  Fly   164 QINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQ--FKTEKTVPM------PF-Y 219

  Fly   203 TTQMMYTEAPM-----DFFNN--DQVRG--VMVPFK---------------NSDMGMLVLLPRP- 242
            |:...|:...|     .|..|  :|:|.  :.:|::               |||:.|:::|| | 
  Fly   220 TSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILP-PF 283

  Fly   243 -RYSTQQILY-----SLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAA 301
             ..|.:.:|.     |||..||..:.|  :..:.||||:..:.::||..|..:|:..:| :.:.|
  Fly   284 NSNSLEDVLSRLNADSLDDSLKQAMPR--EIEVSLPKFEFEQRLELNPILAKMGVSKMF-DESVA 345

  Fly   302 NFKQYNSFDADQNRVLMTIDVGDD-------FDDR--------VVYV--------------NRGF 337
            .|....|         .||.:||.       .|:.        |::.              |..|
  Fly   346 TFDDLTS---------ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPF 401

  Fly   338 VFVVKDKST 346
            :||:.|:::
  Fly   402 LFVIYDRTS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 92/399 (23%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 92/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.