DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and nec

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:406 Identity:82/406 - (20%)
Similarity:154/406 - (37%) Gaps:109/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SYAYNFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLT----GLNQE 77
            ||...|...|.|::.|.:..:|.|:||.::...|.|:|.:.|..|.::|:.|.:.:    .:.|:
  Fly   105 SYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQD 169

  Fly    78 -EIISLFKEAREKVAQEQFTMGNRIYLSPDY----NASPNITQLSENLGVEVKNMTFSGDQSAAS 137
             |.:..:|:..|..   ..|:..::|.:.:.    ::.....:...:.|.|..:|..:.|.:|. 
  Fly   170 FESVIKYKKHLEGA---DLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAK- 230

  Fly   138 EIKKWLNKWIGKAGGN----LFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKK 198
                 :|.|:.....|    |....|:...||.:.|..:.:...|::....:....:.....|.:
  Fly   231 -----INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGR 290

  Fly   199 PFVYTTQMMYTEAPMDFFNNDQVRGVM-----------VPFKNSDMGMLVLLP------------ 240
              :....||:         ||.|.|:.           :.:|:|...||:|||            
  Fly   291 --ISKVAMMF---------NDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQ 344

  Fly   241 --RPRYSTQQILYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFT-NTNAAN 302
              ||.:...::.:.|         |.:...:.||||:.....|:...||.||:..:|| |:....
  Fly   345 LSRPEFDLNRVAHRL---------RRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTK 400

  Fly   303 FKQYNSFDADQ----NRVLMT--IDVGD-----------------------DFDDRVVYVNRGFV 338
            .       .||    :::|..  |:||:                       :|     ..||.||
  Fly   401 L-------MDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEF-----VANRPFV 453

  Fly   339 FVVKDKSTIYMIGRMD 354
            |.|:..:::..||.::
  Fly   454 FAVRTPASVLFIGHVE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 80/399 (20%)
necNP_524851.1 SERPIN 108..468 CDD:238101 80/400 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.