DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn27A

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:382 Identity:71/382 - (18%)
Similarity:154/382 - (40%) Gaps:67/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLA-RNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGL-NQEEIISLFK 84
            |..:|.|.:.:...| :|.:.||.:::..|.||..:....|..|:|.|...|.: :|..:...::
  Fly    76 FSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYR 140

  Fly    85 EA-----REKVAQEQFTMGNRIYLSPDYNASPNIT-QLSENLGVEVKNMTFSGDQSAASEIKKW- 142
            :.     :|....|..::..:::...........| .|......||:.:.|:..::||..|..| 
  Fly   141 KTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAWA 205

  Fly   143 LNKWIGK-----AGGNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLR--QNKKPF 200
            .|...|:     |..|:  ::.:...|.::...|:     |:.:.......:|...:  |::..|
  Fly   206 ANITQGRLQQLVAPDNV--RSSVMLLTNLIYFNGL-----WRRQFATTFQGSFFRSKDDQSRAEF 263

  Fly   201 VYTTQMMYTEAPMDFFNNDQVRG--VMVPFKNSDMGMLVLLPRPRYSTQQILYSLDTILKIKLRR 263
            :..|...|      :..:::::.  :.:|:|..: .:.||||   |:...|...:..:...:|:.
  Fly   264 MEQTDYFY------YTTSEKLKAQILRLPYKGKN-SLFVLLP---YALNGIHDLVKNLENDELKS 318

  Fly   264 SK------KTHLFLPKFKVSESVDLNMALKALGIQNLFTNT----------------NAANFKQY 306
            ::      |..:.||||......:|...|::||::.:|.::                ..:|..|.
  Fly   319 AQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQK 383

  Fly   307 NSFDADQN----RVLMTIDVGDDFDDRVVY----VNRGFVFVVKDKST--IYMIGRM 353
            ...:.::.    .....:::.:.|......    |||.|||.::::||  |...|::
  Fly   384 AGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 71/380 (19%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 71/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.