DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn43Aa

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster


Alignment Length:379 Identity:78/379 - (20%)
Similarity:149/379 - (39%) Gaps:68/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKEA 86
            |...|.:.|:..|...|.:.||::|:.||||.|...:..|..:|:..|..:.          ||:
  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASA----------KES 84

  Fly    87 REKVAQEQFTM-------------GNRIYLSPDYNASPNITQLSEN-LGVEVKNMTFSGDQSAAS 137
            ::.:|:....:             .|::|...:...|.:..::::. ...||:.:.||.:..|..
  Fly    85 KDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE 149

  Fly   138 EIKKWLNKWIGKAGGNLFGK--NDISQTTQIVAVQGMSYSCVWKN--RETALTNRTFTL--LRQN 196
            :|    |:|:.:...|...:  ..:...|.:..|..:.:...|..  .:....:|.|.|  .|..
  Fly   150 QI----NRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSI 210

  Fly   197 KKPFVYTTQMMYTEAPMDFFNNDQVRGVMVPFKNSDMGMLVLLPRPRYSTQ---QILYSLDTILK 258
            :.|.::.....|.   .|:...| .:.:.:.|:|.::.|..:||..|...|   |.|..:|..|.
  Fly   211 QVPTMFADNWYYY---ADYPELD-AKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLL 271

  Fly   259 IKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFK---------------QYNS 308
            ....:.:...::|||||.....||...|..:||..:|  ::||:|.               |:.:
  Fly   272 EDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMF--SDAADFSNIFQDSPIGTRITKVQHKT 334

  Fly   309 FDADQNRV---------LMTIDVGDDFDDRVVYVNRGFVFVVKDKSTIYMIGRM 353
            | .|.|.:         ...:.:....|.:....:..|.|:::||..:|..|.:
  Fly   335 F-IDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 78/377 (21%)
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 78/377 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.