DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn43Aa

DIOPT Version :10

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster


Alignment Length:109 Identity:27/109 - (24%)
Similarity:44/109 - (40%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 DVVPVTEVDK------IQEIKKDIVMSTAERWDETNSEICEFTTA-PIPHMHTPAYTAD-----A 570
            :||.:|.:||      ::....|.|:..|.|:.......||.:.| ...|::......|     .
  Fly    48 EVVNITYIDKDGKETTVRGKVGDNVLYLAHRFGVEMEGACEASLACTTCHVYVQDEYLDRLAEPE 112

  Fly   571 EREKDLLLRYPLPKAST----FVLTQSTITEKRL-----TRNNY 605
            |:|.|||...|..:.::    .::.|..:...||     |||.|
  Fly   113 EKEDDLLDMAPFLRENSRLGCQIVLQKDLEGMRLQLPQATRNFY 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 serpin 20..352 CDD:381000
Spn43AaNP_524805.1 serpin42Dd-like_insects 27..390 CDD:381070 27/109 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.