DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn85F

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:210 Identity:46/210 - (21%)
Similarity:81/210 - (38%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 AVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFVYTTQMMYTEA-PMDFFNNDQVRGVMVPFKNS 231
            |.:|.|      |..|.:.:..|.|..|.   .|:||..:|... ...:|.:.::..:.:.....
  Fly   434 AAEGKS------NYNTDVISHVFYLGNQQ---VVHTTFKVYNAVLYYKYFEHLKMSVLELELDTP 489

  Fly   232 DMGMLVLLPRPRYSTQQILYSLDTILKIKLRRSKK------THLFLPKFKVSESVDLNMALKALG 290
            :..:::||  |.|.|..:..:....|...||..:|      ....:|.||:..::.|...|:.:|
  Fly   490 EYNLMILL--PDYHTDIVAAAASLKLGPTLRLMRKQLKPRWVQAIIPDFKLHGTMFLTNDLQNMG 552

  Fly   291 IQNLFTNTNAANFKQYNSFDADQNR-VLMTIDV--------------GDDFDDRVVYVNRGFVFV 340
            |.::| ..|.|:|:..........| :..:|||              |.......:.||..|:|.
  Fly   553 ICDVF-EPNRADFRPMTEEKGVYVRHIEQSIDVTIRTHPINQLKRNYGAQSKPIQISVNHPFLFF 616

  Fly   341 V--KDKSTIYMIGRM 353
            :  :|.....|.||:
  Fly   617 IVDRDLDVAVMSGRI 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 45/208 (22%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 41/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.