DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn77Bc

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001262103.1 Gene:Spn77Bc / 40236 FlyBaseID:FBgn0036970 Length:416 Species:Drosophila melanogaster


Alignment Length:360 Identity:78/360 - (21%)
Similarity:131/360 - (36%) Gaps:100/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VTDQQLESALQL-----TGLNQE----------EIISLFKEAREKVAQEQFTMGNRIYLSPDYNA 109
            :||.:|:.||.|     |.||.|          .::.:|.|..|....:|......||:  ||  
  Fly    33 MTDARLQFALNLLQMESTHLNLENFAMTPFSTWSLMIMFYEGAEGTTLKQIRDVLAIYV--DY-- 93

  Fly   110 SPNITQLSENL---------GVEVKNMTFS-GDQSAASEIKKWLNKWI--GKAGGNLFGKN---- 158
             |.:.:..|::         ..::.::.:: .|.....|:.|..|..:  |...||:..:.    
  Fly    94 -PTLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPR 157

  Fly   159 --DISQTTQIVA---VQGMSYSCVWKNRETALTNRTFTLL-----------------RQNKKPFV 201
              |..|...|:.   :...|::.::.:......|.|.|:|                 .|.|....
  Fly   158 GVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQF 222

  Fly   202 YT--------TQMMYTEAPMDFFNNDQVRGVM-----VPFKNSDMGMLVLLPRPRYSTQQILYSL 253
            |.        .:||.......:.||  |:|:.     :||...::.|:|:||:|......:|..|
  Fly   223 YNAGGSPAGKVEMMVQTGKYAYVNN--VKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQL 285

  Fly   254 DTI----LKIKLRRSKK---THLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQYNSFDA 311
            ..:    |..:|..||.   ..:.||||.....:.|...:...|:.:|           .|.| |
  Fly   286 KNLGLHRLLEELEASKNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDL-----------RNEF-A 338

  Fly   312 DQNRVLMTIDVGDDFDDRVVYVN--RGFVFVVKDK 344
            |..|:|  |..|    ||..|::  ..|..:|.|:
  Fly   339 DLGRML--IPTG----DRGAYLSLYHQFARIVVDE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 78/360 (22%)
Spn77BcNP_001262103.1 SERPIN 36..410 CDD:238101 76/357 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.