DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn43Ad

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:382 Identity:86/382 - (22%)
Similarity:147/382 - (38%) Gaps:66/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLT-----GLNQEEIIS 81
            |.:.||.:|...:...|.|.||:.|:.||.|||....:....||..||:||     .|..::..:
  Fly    39 FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFET 103

  Fly    82 LFKEAREKVAQEQFTMGNRIYLSPDYNASPNIT--------QLSENLGVEVKNMTFSGDQSAASE 138
            |..:.::..|     :|.|:.|..|..|....|        .|:..:||....:::....:||.:
  Fly   104 LLTDLKQSAA-----IGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQD 163

  Fly   139 IKKWLNKWIGKAGGNLFGKNDI----SQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKP 199
            |..........:.|.|.....:    ...|..:.|.|:::...|.........::........:|
  Fly   164 INYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRP 228

  Fly   200 FVYTT-----QMMYTEAP-MDFFNNDQVRGVMVPFKNSDMGMLVLLP-RP-------RYSTQQIL 250
            .:...     :..|.|.| :|      .:.:.|||..:|:.||::.| ||       |...|..|
  Fly   229 RLVDAMFGQHRYRYAEVPALD------AQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDL 287

  Fly   251 YSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAAN--FKQYNSFDAD- 312
            :.|.:.|:     .:|..|.|||.:|....||...|:.||:..|||:....:  |....|..|. 
  Fly   288 HQLRSQLE-----ERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPP 347

  Fly   313 -----QNRVLMTIDVGDDFDDRVVY-----------VNRGFVFVVKDKSTIYMIGRM 353
                 |:.:|...:.|.:.||...:           :|..|.:.:.:..|:.:.|.:
  Fly   348 LGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVINHPFFYAIGNGKTLLLSGHI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 86/380 (23%)
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 86/380 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26866
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.