DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn42Dc

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster


Alignment Length:404 Identity:78/404 - (19%)
Similarity:147/404 - (36%) Gaps:111/404 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLAR------NFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEII 80
            |..||...::|..|.:      |.|:||.:::.||.|.::.....|.::|.:.|||...::..|.
  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIA 75

  Fly    81 SLFKE---------AREKVAQEQFTMGNRIYLSPDYNASPNITQLSENLGVEVKNMTFSGDQSAA 136
            ..|.|         .|..|.:..    ||:|::..........:::.:........|...|...|
  Fly    76 LNFGEFWRTSCNYGDRGPVLKSV----NRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGA 136

  Fly   137 SEIKKWLNKWIGKAG----GNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNK 197
            :::   :|.|:.:..    .||...:.::..|..:.:..:.:...|                  :
  Fly   137 TQL---INDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKW------------------Q 180

  Fly   198 KPFVYTT----------------QMMYTEAPMDFFNNDQV--RGVMVPFKNSDMGMLVLLPRPRY 244
            |||:..|                .|||.|....|....|:  |.|.:|:..|::.||:|||....
  Fly   181 KPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVN 245

  Fly   245 STQQILYSLDTILKIKLRRS---KKTHLFLPKFKVSESVDLNMALKALGIQNLFTN--------- 297
            ..|::...|:|:....:..:   :...:|||:..:...|||...|..|||..:|::         
  Fly   246 GLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFT 310

  Fly   298 ------TNAANFKQYNSFDADQNRVLMTIDVGD------------------DFDDRVVYVNRGFV 338
                  .:||..:.|             |||.:                  :.:.::...:..||
  Fly   311 SQSGQKISAARHRGY-------------IDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFV 362

  Fly   339 FVVKDKSTIYMIGR 352
            |.:::...::..||
  Fly   363 FYIRNPQAVFFAGR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 78/404 (19%)
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 78/404 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.