DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn31A

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:404 Identity:87/404 - (21%)
Similarity:151/404 - (37%) Gaps:110/404 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HSYAYNFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEII 80
            ||.|.:|            ..:|.|.||:.:...|.||:|..|..|.::|:..|:|    ::...
  Fly    20 HSIATSF------------AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL----KQRFA 68

  Fly    81 SLFKEAREKVAQEQFTMGNRIYLSPDYNASPNITQLSENLGVEVKNMTFSGDQSAASEIKKWLNK 145
            |..|.|....|:    :||   ::.|   :....||...|       ..|.:...|.:.:|....
  Fly    69 SNAKMANFYAAE----LGN---ITTD---ADTFLQLQNRL-------MLSSESGVADDFQKIAQT 116

  Fly   146 WIGKAGGNLFGKNDISQT--------TQIVA-VQGMSYSCVWKNRETA---LTNRTFTLLRQNKK 198
            :.......:    |:.||        .||:| |.|.|    ||:...|   ..|....||..|.:
  Fly   117 YFHATAECV----DLEQTEKLRRHISEQILASVGGGS----WKDIHVAGGSSANTLLLLLAANLQ 173

  Fly   199 -----PF-VYTTQM-------MYTEAPMDFFNND-----------QVRGVMVPFKNS-DMGMLVL 238
                 || .|.|.:       .....|| .|::|           ..|.:.:|:::: ::.||::
  Fly   174 SKWFLPFSAYRTGLYEFHSGSQVKSVPM-LFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLI 237

  Fly   239 LPRPRYSTQQI---LYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNA 300
            ||..|...|::   |:.||.....:..:.:...:.||||.:.....|...||.||.:.:|  ..:
  Fly   238 LPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF--AAS 300

  Fly   301 ANFKQYNS------FDADQN-RVLMT-------------------IDVGDDFDDRVVYVNRGFVF 339
            ||||..::      .|..|. |:.:.                   |.:.:....:....:..|.|
  Fly   301 ANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFF 365

  Fly   340 VVKDKSTIYMIGRM 353
            .::.::..|::|.:
  Fly   366 AIRSENVTYLMGHV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 84/397 (21%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 87/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.