DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn28Da

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:374 Identity:80/374 - (21%)
Similarity:156/374 - (41%) Gaps:69/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TKQLSKGRLARNFVY----SPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKEAR 87
            ||||.:..|..|..|    ||:.:...:.::.:..|..|..:|.:||.|.. :::.:.:::.:..
  Fly    18 TKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE-DKKNVATIYDKLL 81

  Fly    88 EKVAQEQ----FTMGNRIYLSPDYNASPNITQL-SENLGVEVKNMTFSGDQSAASEIKKW-LNKW 146
            .|:.:.:    ..:.||::::.....:....:| :::...|.:.:..:....||..|..| |::.
  Fly    82 TKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQT 146

  Fly   147 IGKAGGNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFVYTTQMMYTEA 211
            :... .::...:|::.....|.:....:...||.|          ..:.|.||.|:.....| :.
  Fly   147 LDNV-KDIIIPSDLTPDESAVMINAAFFKGYWKTR----------FDKMNTKPKVFYVSKSY-QV 199

  Fly   212 PMDFFNN-----------DQVRGVMVPFKNSDMGMLVLLPRPRYSTQQILYSLDTILKIKLRRSK 265
            .::..:.           ||:  :.:||..|::.|:::||:...|..|...::::..:|.| ...
  Fly   200 NVNMMSQVGRFKMRTSTIDQI--IELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVL-TEM 261

  Fly   266 KTHLFLPKFKVSESVDLNMALKALGIQNLFT---------NTNAANFKQY--------------- 306
            ..|:.|||||:...::|...||::|||:||.         |.:.....|.               
  Fly   262 DVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSA 326

  Fly   307 NSFDADQNRVLMTIDVGDDFDDRVV--YVNRGFVFVVKDKSTIYMIGRM 353
            .|..|...|.|      .|:...||  .||..|||:::|...||..||:
  Fly   327 GSASASPIRGL------SDYATSVVTFTVNSPFVFMIRDDDNIYFRGRV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 79/372 (21%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 79/372 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.