DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Spn28B

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:388 Identity:81/388 - (20%)
Similarity:151/388 - (38%) Gaps:65/388 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IFLLKHSYAYNFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQ----- 70
            :.||..|....|..:..:.|:.....||.:||||:....:.::|::....|.::|.:.|:     
  Fly     6 LLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK 70

  Fly    71 -LTGLNQEEIISLFKEAREKVAQEQFT---MGNRIYLSPDYNASPNITQLSEN-LGVEVKNMTFS 130
             |...|...::|..|.      :|.|.   |.||||::..|...|...||:.. ...:.|::...
  Fly    71 TLVANNYRSLLSDLKR------RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLD 129

  Fly   131 GDQSAASEIKKW-LNKWIGKAGGNLFGKNDISQTTQIVAVQGMSYSCVW-KNRETALTNRTFTLL 193
            ...||::.:..| ||:..|.. .|:....|.:..|....|..:.:...| .|.:...|:.....:
  Fly   130 DPVSASAIVNSWILNRTRGMI-RNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYV 193

  Fly   194 RQNKKPFVYTTQMMYTEAPM--DFFNNDQVRGVMVPFKNSDMGMLVLLPRPRYSTQQILYSLDTI 256
            ..|:   :...:||...|.:  .:.::...:.:.:|:.||.:.|.::||.          |:|.:
  Fly   194 SANE---IIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPN----------SVDGL 245

  Fly   257 LKIKLR--------RSKKTHLFLPKFKVSESVDLNMALKALGIQNLF---TNTNAANFKQYNSFD 310
            .|:|.:        ..|..::.|||||:.....|....:.|||.::|   .:.|....:.....|
  Fly   246 RKLKEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKID 310

  Fly   311 ADQNRVLMTIDV--GD-------------DFDDRV-----VYVNRGFVFVVKDKSTIYMIGRM 353
            ....:..:.||.  |:             ..|:.:     ...:..|.:|:.|...||..|.:
  Fly   311 KIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 78/376 (21%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 78/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.