DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:374 Identity:93/374 - (24%)
Similarity:168/374 - (44%) Gaps:49/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYL-SKDNVTDQQLESALQLTGLNQEEIISLFK- 84
            |.:.|...||:.....| ::||.:|..||.:::| :|.:.....|..|......:.|:|.|.|: 
  Rat    11 FALELFHTLSESSPTGN-IFSPFSISSALAMVFLGAKGSSAPSSLRLAETFHFDSVEDIHSRFQS 74

  Fly    85 ---EAREKVAQEQFTMGNRIYLSPDYNASPNITQLSENL-GVEVKNMTFSGDQSAASEIKKWLNK 145
               |.|:..|.....:.||:|....||..|.....::.: |.::..:.|   |.|:.:.:|.:||
  Rat    75 LNAEMRKHGASHTLKVANRLYGEKTYNFLPEFLASTQKMYGADLAPVDF---QHASEDARKEINK 136

  Fly   146 WI-GKAGG---NLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTL-LRQNKKPFVYTTQ 205
            |: |:..|   .|.....::.||::|.|..:.:..:|  :|..||..|... .|.|||. ....:
  Rat   137 WVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIW--QEKFLTRHTTDAPFRLNKKD-TKMVK 198

  Fly   206 MMYTEA--PMDFFNNDQVRGVMVPFKNSDMGMLVLLPR---------PRYSTQQILYSLDTILKI 259
            |||.:.  |..:..:.:.:.:.:|::..::.|::|||.         .:...|..|..|....|.
  Rat   199 MMYQKEKFPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIEEQLTLEKLYEWTKH 263

  Fly   260 KLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQYNSFDADQNRVL--MTIDV 322
            :..:....|:.|||||:.||..||..|..||:|:||:::.|.......|.|...::::  ..::|
  Rat   264 ENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLFSSSKADLSGMSESRDIFISKIVHKSFVEV 328

  Fly   323 GDDFDDR-------VVY---------VNRGFVFVVKDKSTIYMI--GRM 353
            .::..:.       |.|         |:..|:|.::...|..|:  ||:
  Rat   329 NEEGTEAAAATAGLVEYCLVSIEAFIVDHPFLFFIRHNPTANMLFFGRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 92/372 (25%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 93/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.