DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SERPIND1

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:399 Identity:92/399 - (23%)
Similarity:164/399 - (41%) Gaps:91/399 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLKHSYAYNFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQ----LTG 73
            :|...:|:|....|..|::   ...|...:|:.|..|:|::.|.....|.:|:.|.|.    :..
Human   128 ILNAKFAFNLYRVLKDQVN---TFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNA 189

  Fly    74 LNQEEII---SLFKEAREKVAQEQF--TMG--NRIYLSPDYNASPNI----TQLSENLGVEVKNM 127
            .::.||.   :||::...::.:..|  |:.  |.:|:...:   |.:    |::.|....|.:..
Human   190 SSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQF---PILLDFKTKVREYYFAEAQIA 251

  Fly   128 TFSGDQSAASEIKKWLNKWIGKAGGNLF--GKNDISQTTQIVAVQGMSYSCVWKNR-ETALT-NR 188
            .|| |.:..|:    .|..|.|....|.  ...:|...||::.:..:.:...|.|: ...:| |.
Human   252 DFS-DPAFISK----TNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNH 311

  Fly   189 TFTLLRQNKKPFVYTTQMMYT----------EAPMDFFNNDQVRG----VMVPFKNSDMGMLVLL 239
            .|   |.|::. |....||.|          |...|....:.|.|    ::||.|.|.|..|...
Human   312 NF---RLNERE-VVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ 372

  Fly   240 PRPRYSTQQILYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLF-TNTNAANF 303
            ..||.        ::...|....|:::  :.|||||:.::.:|..:||.:||:.|| .|.|.|..
Human   373 LTPRV--------VERWQKSMTNRTRE--VLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGI 427

  Fly   304 KQYNSFDADQNRVLM-------TIDVGDD--------------FDDRVVY-VNRGFVFVVKDKST 346
                   :|| |:.:       ||.|.::              ...:|.: |:|.|:|::.:..|
Human   428 -------SDQ-RIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIYEHRT 484

  Fly   347 --IYMIGRM 353
              :..:||:
Human   485 SCLLFMGRV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 89/389 (23%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 92/399 (23%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.