DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and LOC299282

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:371 Identity:88/371 - (23%)
Similarity:155/371 - (41%) Gaps:72/371 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYL-SKDNVTDQQLES-ALQLTGLNQEEIISLF 83
            :|.::|.|:|:.....:|.|:||::|..||.:|.| :||:..::.||. ...||.:.:|||...|
  Rat    51 DFALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGF 115

  Fly    84 KEAREKVAQE----QFTMGNRIYLSPDYNASPNITQLSENLGVEVKNMTFSGDQSAASEIKKWLN 144
            ....::::|.    :...|:.:::..:   .|.:::..|......:...|..|....:|.||.:|
  Rat   116 GHLLQRLSQPEDQVEINTGSALFIDKE---QPILSEFQEKTRALYQAEAFIADFKQPNEAKKLIN 177

  Fly   145 KWI-----GKAGGNLFGKNDISQTTQIVAVQGMSYSCVWK---NRETALTNRTF-TLLRQNKKPF 200
            .::     ||. ..||  :|:.:.|.:|.|..:.:...||   |     .|.|| :....::|..
  Rat   178 DYVSNQTQGKI-AELF--SDLEERTSMVLVNYLLFKGKWKVPFN-----PNDTFESEFYLDEKRS 234

  Fly   201 VYTTQMMYTEAPMDFFNNDQVRGVMVPFK-NSDMGMLVLLPRPRYSTQQILYSL--DTILKIK-- 260
            |....|...|....:..::::...::..| ..:...|.:|| .:...||:..||  :|:.|.|  
  Rat   235 VKVPMMKIKEVTTPYVRDEELSCSVLELKYTGNASALFILP-DQGKMQQVESSLQPETLKKWKDS 298

  Fly   261 LRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQYNSFDADQNRVLMTIDVGD- 324
            |.......|.:|||.:|....|...|..|||:.:|            |..||.:|:..|.|:.. 
  Rat   299 LIPRIINDLRMPKFSISTDYSLKEVLPELGIKKVF------------SQQADLSRITGTKDLYVS 351

  Fly   325 --------DFDD-------------------RVVYVNRGFVFVVKD 343
                    |.|:                   |.:..||.|:.|:.|
  Rat   352 QVVHKAVLDVDETGTEATAATGVATVIRRQPRTLNFNRPFMVVITD 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 88/371 (24%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 88/371 (24%)
RCL 365..389 1/23 (4%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.