DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and Serpine2

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus


Alignment Length:380 Identity:87/380 - (22%)
Similarity:147/380 - (38%) Gaps:69/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 INLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKEARE 88
            |.:..|:.|.:...|.|.||..|...||:|.|..|..|.:||.:.::   .|...:..:.|:..:
  Rat    36 IQVFNQIIKSQPHENVVISPHGIASILGMLQLGADGRTKKQLSTVMR---YNVNGVGKVLKKINK 97

  Fly    89 KVAQEQ----FTMGNRIYLSPDYNAS-PNITQLSENLGVEVKNMTFSGDQSAASEIKKWLNKWIG 148
            .:..::    .|:.|.:::...:... |...:..|....||:::.|....||...|..|:.....
  Rat    98 AIVSKKNKDIVTVANAVFVRNGFKVEVPFAARNKEVFQCEVQSVNFQDPASACDAINFWVKNETR 162

  Fly   149 KAGGNLFGKNDI-SQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFV------YTTQM 206
            ....||...|.| |..|::|.|..:.:..:||:|        |......|:.||      |...|
  Rat   163 GMIDNLLSPNLIDSALTKLVLVNAVYFKGLWKSR--------FQPENTKKRTFVAGDGKSYQVPM 219

  Fly   207 MYTEAPMDFFNNDQVRG--------VMVPFKNSDMGMLVLLPR----------PRYSTQQILYSL 253
            :   |.:..|.:...:.        :.:|:....:.||:.||.          |..||:.|...:
  Rat   220 L---AQLSVFRSGSTKTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTINSWM 281

  Fly   254 DTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLF--TNTNAANFKQYNSFDADQNRV 316
            :|::      .|:..|.||||......||...||||||..:|  :..|.|...:..|........
  Rat   282 NTMV------PKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEPSKANFAKITRSESLHVSHILQ 340

  Fly   317 LMTIDVGDDFDDRVV---------------YVNRGFVFVVKDKST--IYMIGRMD 354
            ...|:|.:|.....|               .|:|.|:|.::...|  |..:|:::
  Rat   341 KAKIEVSEDGTKAAVVTTAILIARSSPPWFIVDRPFLFCIRHNPTGAILFLGQVN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 87/377 (23%)
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 87/378 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.