DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SERPINA12

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:280 Identity:49/280 - (17%)
Similarity:114/280 - (40%) Gaps:16/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIIS----LFKEA 86
            |.|:|:.....||...||::|..|..:|.|...:.|..:::.......:.::::..    :..|.
Human    59 LLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHEL 123

  Fly    87 REKVAQEQFTMGNRIYLSPDYNASPNITQLSENL-GVEVKNMTFSGDQSAASEIKKWLN-KWIGK 149
            .:|....:.::||.:::...........:.::|. ..|.....|...:.|..:|..::: |..||
Human   124 TQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGK 188

  Fly   150 AGGNLFGKNDISQTTQIVAVQGMSYSCVWKNR-ETALTNRTFTLLRQNKKPFVYTTQMMYTEAPM 213
            . .||.  .:|...|.::....:.:...||:. :..:|......|.:|....|   .||:.....
Human   189 I-NNLI--ENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKV---PMMFRSGIY 247

  Fly   214 DFFNNDQVRGVM--VPFKNSDMGMLVLLPRPRYSTQQILYSLDTILKIKLRRSKK-THLFLPKFK 275
            ....:|::...:  :|::.:...:.:|....:....:....:||..:.|...|:: ..:.:|:..
Human   248 QVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLH 312

  Fly   276 VSESVDLNMALKALGIQNLF 295
            ::.:.||...|..:|:..:|
Human   313 MTGTFDLKKTLSYIGVSKIF 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 49/280 (18%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 49/280 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.