DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SERPINA3

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:385 Identity:85/385 - (22%)
Similarity:157/385 - (40%) Gaps:74/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQ--LTGLNQEEIISLF 83
            :|..:|.|||......:|.::||::|..||..|.|...|.|..::...|:  ||..::.||...|
Human    55 DFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSF 119

  Fly    84 KEAREKVAQE----QFTMGNRIYLSPDYNASPNITQLSENL-GVEVKNMTFSGDQSAASEIKKWL 143
            :.....:.|.    |.:|||.:::....:.....|:.::.| |.|    .|:.|...::..||.:
Human   120 QHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSE----AFATDFQDSAAAKKLI 180

  Fly   144 NKWIGKAGGNLFGK-----NDISQTTQIVAVQGMSYSCVWK---NRETALTNRTFTLLRQNKKPF 200
            |.:: |.|..  ||     .|:...|.:|.|..:.:...|:   :.:....:|.:.    :||.:
Human   181 NDYV-KNGTR--GKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYL----SKKKW 238

  Fly   201 VYTTQMMYTEAPMDFFNNDQVRGVMVPFK-NSDMGMLVLLPRPRYSTQQILYSLDT-ILKIKLRR 263
            |....|......:.:|.::::...:|..| ..:...|.:||     .|..:..::. :|...|:|
Human   239 VMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILP-----DQDKMEEVEAMLLPETLKR 298

  Fly   264 SKKT-------HLFLPKFKVSESVDLNMALKALGIQNLFTN-------TNAANFKQYNSFDADQN 314
            .:.:       .|:||||.:|...:||..|..|||:..||:       |.|.|..      ..|.
Human   299 WRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLA------VSQV 357

  Fly   315 RVLMTIDVGDDFDD-------------------RVVYVNRGFVFVV--KDKSTIYMIGRM 353
            .....:||.::..:                   .:|..||.|:.::  .|...|:.:.::
Human   358 VHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 85/383 (22%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 85/385 (22%)
RCL 369..394 0/24 (0%)
O-glycosylated at one site 381..389 0/7 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.