DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and serpina10

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:390 Identity:87/390 - (22%)
Similarity:164/390 - (42%) Gaps:90/390 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYL-SKDNVTDQQLESALQLTGLN------QEE 78
            :|..||.:::: .:...|..:||.::...|..|.| ::.|..||.|.      |||      ||.
 Frog    75 DFGFNLYRKIA-NKHDNNIFFSPFSVSLGLSSLLLGTRGNTYDQLLH------GLNYNPFKDQEN 132

  Fly    79 ---IISLFKEAREKVAQEQ---FTMGNRIYLSPDYNASPNITQLSEN-LGVEVKNMTFSGDQSAA 136
               :..|.|..:||:|:.:   ..:|:..:|...::.......|::. ..:|.:.:.|.     :
 Frog   133 PYLLPELLKTIKEKIAKNEELVLNIGSLSFLHETFSMKDEFVNLTKKYFDMEYELIDFH-----S 192

  Fly   137 SEIKKWLNKWIGKAGGNLFGK--NDISQTTQIVAVQGMSYSCVWKNR-ETALTN-RTFTLLRQNK 197
            |:.|..:|.::.|....|...  :.|...|:::.:..:.:...|:.. ..|||. .:|.:.:.|.
 Frog   193 SKAKNEINAYVEKLTKGLISNFYDFIDPQTKLLLLDYIFFKGKWQYPFNPALTEVDSFFIDKYNS 257

  Fly   198 KPFVYTTQMMY-TEAPMDFFNND--------QVRG-----VMVPFKNSDMGMLVLLPRPRYSTQQ 248
                .|..||| |:.....|:.|        ..||     ::.|.|..|.|:|     ..:.|::
 Frog   258 ----VTVPMMYKTDKVASVFDKDLSCTVFKLPYRGNAHMLIIKPEKEGDFGIL-----EDHLTKE 313

  Fly   249 ILYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQYNSFDADQ 313
            ::.|....:     :|:||.:|.||||:.:...|..:|..|||:.|||.       :.|..|..:
 Frog   314 LINSWQAKM-----QSRKTDIFFPKFKLDQKYKLKSSLNELGIKELFTG-------KANLTDLTE 366

  Fly   314 NRVLMTIDVGD----DFDDR-------------------VVYVNRGFVFVVKDKS--TIYMIGRM 353
            .|.||..::..    :.|:|                   .:.|||.|:|::.:::  ::..:||:
 Frog   367 ERNLMLTEITQQAMIEVDERGTEAAAVAGAEIIAYSLPLTIRVNRPFLFMIFEEAYQSLLFLGRV 431

  Fly   354  353
             Frog   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 86/388 (22%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 87/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.