DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and AT1G20270

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:209 Identity:67/209 - (32%)
Similarity:98/209 - (46%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 EEISLDPFMAMYHEVLYDSEIRELKGQSM-NMVNGYASQRNGTEIRDTVVRYDWWSNTSLVRER- 387
            |.:|.:|...:||..|...|...|...:. :||..........:.:|:.||..  |.|.|.|.| 
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTS--SGTFLRRGRD 139

  Fly   388 -----INQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNITTLGDRLASILFYA 447
                 |.:||.|.|.......|.||:.:|..|..::||:||..|.|.|.|   .|.|:|::|.|.
plant   140 KIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKN---GGQRMATMLMYL 201

  Fly   448 SEVPQGGATVFPEIN-------------------VTVFPQKGSMLYWFNLHDDGKPDIRSLHSVC 493
            |:|.:||.||||..|                   ::|.|:.|..|.::::..|...|..|||..|
plant   202 SDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGC 266

  Fly   494 PVLNGDRWTLTKWV 507
            ||:.|::|:.|||:
plant   267 PVIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 60/191 (31%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 66/207 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.