DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and AT5G66060

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:215 Identity:65/215 - (30%)
Similarity:103/215 - (47%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LEEISLDPFMAMYHEVLYDSEIR---ELKGQSM---NMVNGYASQRNGTEIRDTVVRYDWWSNTS 382
            :|.||.:|..::||..|...|.:   ||....|   .:|:....:...:.:|.:       |.|.
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTS-------SGTF 135

  Fly   383 LVRER------INQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNITTLGDRLA 441
            |.|.|      |.:||.|.|.......|.||:.:|.:|..::||:||..|.:.|.|   .|.|:|
plant   136 LARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRN---GGQRIA 197

  Fly   442 SILFYASEVPQGGATVFP-------------EIN------VTVFPQKGSMLYWFNLHDDGKPDIR 487
            ::|.|.|:|.:||.||||             |::      ::|.|:.|..|.::::..|...|..
plant   198 TVLMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPS 262

  Fly   488 SLHSVCPVLNGDRWTLTKWV 507
            |||..|.|:.|::|:.|||:
plant   263 SLHGGCAVIKGNKWSSTKWL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 57/196 (29%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 65/215 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.