DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and AT4G35810

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:210 Identity:69/210 - (32%)
Similarity:100/210 - (47%) Gaps:33/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LEEISLDPFMAMYHEVLYDSEIREL--KGQSMNMVNGYASQRNGTEIRDTVVRYDWWSNTSLVR- 385
            ||.||.:|...:||..|.:.|...|  ..:...|.:.....:.|..| |:.||..  |.|.|.| 
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSI-DSRVRTS--SGTFLNRG 141

  Fly   386 -----ERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNITTLGDRLASILF 445
                 |.|..||.|.|.......|.||:.:|.:|..::||.||..|.|   |:...|.|:|::|.
plant   142 HDEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEF---NVRKGGQRIATVLM 203

  Fly   446 YASEVPQGGATVFP-------------EIN------VTVFPQKGSMLYWFNLHDDGKPDIRSLHS 491
            |.|:|.:||.||||             |::      ::|.|:|...|.::::..|...|..|||.
plant   204 YLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHG 268

  Fly   492 VCPVLNGDRWTLTKW 506
            .|||:.|::|:.|||
plant   269 GCPVIKGNKWSSTKW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 61/193 (32%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 69/210 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.