DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and AT4G33910

DIOPT Version :10

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:123 Identity:41/123 - (33%)
Similarity:57/123 - (46%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 EKLQIANYGLGTYFQPHFDYSSDGFETPNITTLG----DRLASILFYASEVPQGGATVFPE---- 460
            |...|..|.||..:..|:|..       |.|..|    .|:||.|.|.|:|.:||.|:||.    
plant   166 ESFNILRYELGQKYDSHYDVF-------NPTEYGPQSSQRIASFLLYLSDVEEGGETMFPFENGS 223

  Fly   461 -----------INVTVFPQKGSMLYWFNLHDDGKPDIRSLHSVCPVLNGDRWTLTKWV 507
                       |.:.|.|:||..|.::::..:|..|..|||..|||..|::|..|||:
plant   224 NMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVATKWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..167 CDD:462433
P4Hc 341..507 CDD:214780 40/121 (33%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 41/123 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.