DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and AT3G28490

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:219 Identity:63/219 - (28%)
Similarity:104/219 - (47%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PLKLEEISLDPFMAMYHEVLYDSE----IRELKG---QSMNMVNGYASQRNGTEIRDTVVRYDWW 378
            |.::.::|..|...:|...|.|.|    |:..||   :||.:.:..:.:...:|:|.        
plant    29 PTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRT-------- 85

  Fly   379 SNTSLVRERINQRIID----MTGFNFLKDEK---LQIANYGLGTYFQPHFDYSSDGFETPNITTL 436
            |:...:.:|.:..:.:    :..:.||.:|.   |||.:|..|..:.|||||.   ::...:...
plant    86 SSGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYF---YDKKALELG 147

  Fly   437 GDRLASILFYASEVPQGGATVFP------------------EINVTVFPQKGSMLYWFNLHDDGK 483
            |.|:|::|.|.|.|.:||.||||                  :....|.|:||..|.:||||.:|.
plant   148 GHRIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGT 212

  Fly   484 PDIRSLHSVCPVLNGDRWTLTKWV 507
            .|..|||..|||:.|::|:.|:|:
plant   213 TDPNSLHGSCPVIEGEKWSATRWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 57/197 (29%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 63/219 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.