DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and P4H13

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:176 Identity:49/176 - (27%)
Similarity:76/176 - (43%) Gaps:33/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 KGQSMNMVNGYASQRNGTEIRDTVVRYDWWSNTSLVRERINQRIIDMTGFNFLKD--EKLQIANY 411
            ||::......|.|....|:           .:.|.|...|.::|...|  .|.||  |...|..|
plant   109 KGETAETTQNYRSLHQHTD-----------EDESGVLAAIEEKIALAT--RFPKDYYESFNILRY 160

  Fly   412 GLGTYFQPHFDYSSDGFETPNITTLGDRLASILFYASEVPQGGATVFPE---------------I 461
            .||..:..|:|........|.|:   .|:.:.|.:.|.|.:||.|:||.               :
plant   161 QLGQKYDSHYDAFHSAEYGPLIS---QRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCV 222

  Fly   462 NVTVFPQKGSMLYWFNLHDDGKPDIRSLHSVCPVLNGDRWTLTKWV 507
            .:.|.|::|..::::||..:|..|..|||..|||:.|::|..|||:
plant   223 GLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVATKWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 48/174 (28%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 49/176 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.