DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and P4H5

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:209 Identity:69/209 - (33%)
Similarity:100/209 - (47%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LEEISLDPFMAMYHEVLYDSEIRELKGQSM-NMVNGYASQRNGTEIRDTVVRYDWWSNTSLVR-- 385
            :|.||.:|...:||..|.:.|...|...:. :||............:|:.||..  |.|.|.|  
plant    80 VEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTS--SGTFLRRGH 142

  Fly   386 ----ERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNITTLGDRLASILFY 446
                |.|.:||.|.|.......|.||:.:|.:|..::||:||..|.|.|.|   .|.|:|::|.|
plant   143 DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKN---GGQRIATVLMY 204

  Fly   447 ASEVPQGGATVFP-------------EIN------VTVFPQKGSMLYWFNLHDDGKPDIRSLHSV 492
            .|:|..||.||||             |::      ::|.|:|...|.::|:..|...|..|||..
plant   205 LSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGG 269

  Fly   493 CPVLNGDRWTLTKW 506
            |||:.|::|:.|||
plant   270 CPVVKGNKWSSTKW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 62/192 (32%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 69/209 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.