DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:212 Identity:46/212 - (21%)
Similarity:85/212 - (40%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 LKLEEISLDPFMAMYHEVLYDSEIRE-------LKGQSMNMVNGYAS-------QRNGTEI--RD 370
            :|:|.::..|.:.:|.::....::|:       ||.:...:||...:       :.|||::  .|
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQVFHED 86

  Fly   371 TVVRYDWWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDY-----SSDGFET 430
            .......|.....:          :...||...|.:...:|..|.::..|.||     ..:..|.
 Worm    87 HPAARSIWDTAKNL----------LPNLNFKTAEDILALSYNPGGHYAAHHDYLLYPSEKEWDEW 141

  Fly   431 PNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHDDGKPDIRSLHSVCPV 495
            ..:.  |:|..:::........|||||||.:...|..:.|...:|||...:.:.:..|.|:.||:
 Worm   142 MRVN--GNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHAGCPI 204

  Fly   496 LNGDRWTLTKWVPMFPQ 512
            ..|.:...|.|:.|..|
 Worm   205 YKGQKQISTIWLRMRDQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 39/186 (21%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 40/185 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.