DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32201 and LOC110438249

DIOPT Version :9

Sequence 1:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:236 Identity:84/236 - (35%)
Similarity:127/236 - (53%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 RQKTNLVCRYKSTANTFLRLAPLKL--EEISLD-PFMAMYHEVLYDSEIRELK---------GQS 352
            :::..|||||:..     |..||.|  ||:..| |.:..||:.|.:.||..:|         .|.
Zfish     4 QRERKLVCRYRRG-----RGNPLMLFKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQV 63

  Fly   353 MNMVNGYASQRNGTEIRDTVVRYDW-WSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTY 416
            ::.|:|   :|.....|  |.:..| :.:...|..::||||.|:||......|.|||||||:|..
Zfish    64 IDAVSG---KRVSAASR--VSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQ 123

  Fly   417 FQPHFD--YSSDGFETPNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLH 479
            ::||:|  .::|.    :....|.|:|::|.|.|:|..|||||||::...:.|::||.:.||||.
Zfish   124 YEPHYDSKLTNDS----DFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLL 184

  Fly   480 DDGKPDIRSLHSVCPVLNGDRWTLTKWVPMFPQMFSFPCKS 520
            .:|..|||:||:.|||..|.:|...||:..:.|.|...|.:
Zfish   185 RNGNEDIRTLHAACPVFVGSKWVANKWIRTYGQEFRRKCST 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528
P4Hc 341..507 CDD:214780 64/177 (36%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 70/198 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.