DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and sts

DIOPT Version :9

Sequence 1:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_005168454.1 Gene:sts / 402795 ZFINID:ZDB-GENE-030717-5 Length:584 Species:Danio rerio


Alignment Length:448 Identity:117/448 - (26%)
Similarity:173/448 - (38%) Gaps:112/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLLLCLQRVKSDESAAARRPNIIIIMADDMGFDDVSFRGGREFLTPNIDALAYHG-RLLDRLYA 70
            |.|||     .:.::.:..:||.:.:|.||:|..|:...|.....|||||.||..| :|...:.|
Zfish    11 FCLLL-----YTADAGSGTKPNFVFMMVDDLGIGDLGCYGNTTLRTPNIDRLALEGVKLTQHIAA 70

  Fly    71 PAMCTPSRGALLSGRYPIHTG-TQH-----FVISNEEPWALTLNATLMPEIFKEAGYSTNLVGKW 129
            ..:|||||.|.|:|||||.:| ..|     |:.| .....|........:..|..||||.::|||
Zfish    71 APLCTPSRAAFLTGRYPIRSGMAAHGHMGVFLFS-ASSGGLPQEEITFAKAVKVQGYSTAVIGKW 134

  Fly   130 HLGFSRPE-----YTPTRRGFDYHFG----------------YWGAYIDYFQRRSKMPVANYSLG 173
            |||.:..:     :.|...||||.:|                .:..|       |.:|....|:|
Zfish   135 HLGLNCEDSSDHCHHPNSHGFDYFYGTIMTHLRDCQPGHGSVLYNVY-------SHIPFKPLSIG 192

  Fly   174 --------------------------------------YDFRRNMELEC-RDRGVYV-------- 191
                                                  |.|   ..|.| ..||..:        
Zfish   193 LVSLVVLHIRGMLTVSRRVFFSFLILVGLVLSLFRLLVYTF---PNLNCFVMRGTEIVEQPYISE 254

  Fly   192 --TDLLTAEAERLIKDHADKEQPLFLMLSHLAAHTANEDDPLQAPEEEIQKFSYIKDPNRRKYAA 254
              |..:|:||...::  .:.|.|..|..|.:..||.....||.....:           ...|..
Zfish   255 NLTQRMTSEAIEFLE--RNSETPFLLFFSFIQVHTGVFASPLFRGRSQ-----------HGLYGD 306

  Fly   255 MISKLDQSVGRIITALSSTDQLENSIVIFYSDNGAPSVGMFS-----NTGSNFPLRGQKNTPWEG 314
            .:.::|.|||:|:..|...:..:|::|...||.| |.:...|     :.|.:...:..|:|.|||
Zfish   307 AVMEVDWSVGQIMQTLERLNLKDNTLVYMTSDQG-PHLEEISVHGEMHGGYSGIYKAGKSTNWEG 370

  Fly   315 GVRVAGAIWSSGLQARGSIFRQPLYVADWLPTLSRAADIELDSSLKLDGIDLWPELSG 372
            |:|:.|.:...|:...|:|..:|....|..||:...|...:.....:||.||.|.|.|
Zfish   371 GIRIPGILSWPGVLPAGNIIDEPTSNMDIFPTVLNLAGASIPDDRVIDGHDLLPLLQG 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_001287102.1 AslA 23..458 CDD:225661 113/432 (26%)
4-S 27..408 CDD:293753 113/428 (26%)
DUF4976 <478..540 CDD:303608
stsXP_005168454.1 PRK13759 23..533 CDD:237491 113/431 (26%)
ES 25..546 CDD:293778 113/429 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.