DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and CG32187

DIOPT Version :9

Sequence 1:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster


Alignment Length:407 Identity:91/407 - (22%)
Similarity:138/407 - (33%) Gaps:97/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 GVYVTDLLTAEAERLIKDHADKEQPLFLMLSHLAAHTA-----NEDDP------LQAPE-----E 236
            |:|  .|||.       |..|.|..:|.::....|..:     |..:|      |:.|:     .
  Fly    30 GIY--PLLTF-------DEDDDEAEIFALMQRKRALASGRKRRNSQEPEDRKQDLKMPKLEWHHP 85

  Fly   237 EIQKFSYIKDPNRRKYAAMISKLDQSVGRIITALSSTDQLENSI--VIFYSDNGAPSVGMFS--- 296
            |:.......|.....|..|         |.:|.|.....||.::  :........|:..|.|   
  Fly    86 ELNLLHRYTDAQFESYLHM---------RKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLAL 141

  Fly   297 ---NTGSNFPLRGQK-NTPWEGGVRVAGAIWSSGLQARGSIFRQPLYVADWLPTLSRAADI---- 353
               :|..:|....:| ..||....:|..|.|........|..:.|..:|....||.....:    
  Fly   142 WKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLR 206

  Fly   354 ---ELDSSLKLDGIDLWPELSGSADAPHVPREILH----ILDDVWRLSALQ-------MGQWKYV 404
               ||...:.|..:|::.| |..||.|.|.:.|.:    |:|....| |::       :||...:
  Fly   207 CFRELFGIITLRRLDVFLE-SEHADVPVVLQLICNAERKIVDCYVEL-AMEYSFEDSPIGQTLAL 269

  Fly   405 NGTTASGRYDSVLTYRELDDLDPRDSRY-----AVTVRNSATSRALSRYDLRRLTQQRISLTRR- 463
            |..|....     :|...:|:.|..|..     |...|..|....:.|.......|...:|.|| 
  Fly   270 NPRTMPAG-----SYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRF 329

  Fly   464 --LAAVRCGDLQR---------SCNPLLEECLYDILSDPCEQN--------NLVYSERHSDVLTA 509
              |.|:...||..         :.:.:.||...|.|.||..::        .:..||:.|   ..
  Fly   330 NTLYALEARDLNEVRLIVESICAMHNICEEYEDDGLEDPGHRSFSWGGVAEGVRGSEKDS---KG 391

  Fly   510 LRRRVQEL-RASASRPG 525
            |:|||:.| ...|..||
  Fly   392 LQRRVELLDELVAIEPG 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_001287102.1 AslA 23..458 CDD:225661 67/317 (21%)
4-S 27..408 CDD:293753 57/262 (22%)
DUF4976 <478..540 CDD:303608 17/57 (30%)
CG32187NP_730303.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.