DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and Arsk

DIOPT Version :9

Sequence 1:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001041382.1 Gene:Arsk / 365619 RGDID:1310182 Length:563 Species:Rattus norvegicus


Alignment Length:524 Identity:118/524 - (22%)
Similarity:187/524 - (35%) Gaps:154/524 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ARRPNIIIIMADDMGFDD-VSFRGGREFL-TPNIDALAYHGRLLDRLYAPA-MCTPSRGALLSGR 85
            |:.||::::.:|  .||. ::|:.|.:.: .|.|:.:...|......|..: :|.|||.|:.||.
  Rat    29 AQAPNVVLVASD--SFDGRLTFQPGSQVVKLPFINFMRARGTTFLNAYTNSPICCPSRAAMWSGL 91

  Fly    86 YPIHTGTQHFVISNEEPW----ALTLNATLMPEIFKEAGYSTNLVGKWHLGFSRPEYTPTRRGFD 146
            :...|          |.|    .|..|.|...::.::.||.|...||                .|
  Rat    92 FTHLT----------ESWNNFKGLDPNYTTWMDVMEKHGYQTQKFGK----------------LD 130

  Fly   147 YHFGY---------WGAYIDYFQRRSKMPVANYSLGYDFRRNMELECRDRGVYVTDLLTAEAERL 202
            |..|:         |...:.:..|:...|:.|.....:.||.|:.:.::     ||...|...::
  Rat   131 YSSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMDKDWQN-----TDKAIAWLRQV 190

  Fly   203 IKDHADKEQPLFLMLSHLAAHTANEDDPLQAPEEE--------------IQKFSY--IKDPN--- 248
                 :..:|..|.|.      .|...|..:|...              ::|.:|  ||.|.   
  Rat   191 -----NSTKPFVLYLG------LNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLA 244

  Fly   249 -----------------------------RRKYAAMISKLDQSVGRIITALSSTDQLENSIVIFY 284
                                         |..|.||.::.|..:|.||.||...:.|:.:|||:.
  Rat   245 LSEMHPVDYYSSYTKNCTGKFTENEIKNIRAFYYAMCAETDAMLGEIILALHKLNLLQKTIVIYT 309

  Fly   285 SDNGAPSVGMFSNTGSNFPLRGQKNTPWEGGVRVAGAIWSSGLQARGSIFRQPLYVA--DWLPTL 347
            ||:|..::     ....|    .|.:.:|....|...:...|::|.   .:.|..|:  |..||:
  Rat   310 SDHGEMAM-----EHRQF----YKMSMYEASAHVPILMMGPGIKAN---LQVPSLVSLVDIYPTM 362

  Fly   348 SRAADIELDSSLKLDGIDLWPELSGSADAPHVPREILHILDDVWRLS------------ALQMGQ 400
            ...|.|.|  .|.|.|..|.| ||.:..|......:.|   ..|.||            .|:.||
  Rat   363 LDIAGIPL--PLNLSGYSLLP-LSSNTSANDQAFRVHH---PPWILSEFHGCNANASTYMLRTGQ 421

  Fly   401 WKYVNGTTASGRYDSVLTYRELDD--LDPRDSRYAVTVRNSATSRALSRYDLRRLTQQRISLTRR 463
            |||:      ...|..|...:|.|  |||.:      :.|.||......|.|.:..:..|:..:.
  Rat   422 WKYI------AYSDGTLVQPQLFDLSLDPDE------LTNIATEFPEITYSLDQQLRSVINYPKV 474

  Fly   464 LAAV 467
            .|:|
  Rat   475 SASV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_001287102.1 AslA 23..458 CDD:225661 115/513 (22%)
4-S 27..408 CDD:293753 102/458 (22%)
DUF4976 <478..540 CDD:303608
ArskNP_001041382.1 ARSK 32..445 CDD:293781 108/480 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351134
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.