DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and GNS

DIOPT Version :9

Sequence 1:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_002067.1 Gene:GNS / 2799 HGNCID:4422 Length:552 Species:Homo sapiens


Alignment Length:489 Identity:110/489 - (22%)
Similarity:183/489 - (37%) Gaps:143/489 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAAARRPNIIIIMADDMGFDDVSFRGGREFLTPNIDALAYHGRLLDRLYAP-AMCTPSRGALLSG 84
            :|..||||:::::.||.  |:|  .||...|......:...|......|.| |:|.|||.::|:|
Human    41 AAGTRRPNVVLLLTDDQ--DEV--LGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTG 101

  Fly    85 RYPIHTGTQHFVISN-------EEPWALTLNATLMPEIFKE-AGYSTNLVGKWHLGFSRP----- 136
            :|| |   .|.|::|       .:.|.........|.|.:. .||.|...||:...:..|     
Human   102 KYP-H---NHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGL 162

  Fly   137 EYTPTRRGFDYHFGYWGAYIDYFQRRSKMPVANYSLGYDFRRNMELECRDRGV-----YVTDLLT 196
            |:.|      ..:.||.|    .::.||.        |::..::..:.|..|.     |:||:| 
Human   163 EHVP------LGWSYWYA----LEKNSKY--------YNYTLSINGKARKHGENYSVDYLTDVL- 208

  Fly   197 AEAERLIKDHADKEQPLFLMLSHLAAHTANEDDPLQAPEEEIQKFSYIKDPN------------- 248
            |.......|:....:|.|:|::..|.|:     |..|..:..:.|..:..|.             
Human   209 ANVSLDFLDYKSNFEPFFMMIATPAPHS-----PWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHW 268

  Fly   249 ---------------------RRKYAAMISKLDQSVGRIITALSSTDQLENSIVIFYSDNGAPSV 292
                                 |:::..::| :|..|.:::..|..|.:|.|:.:.:.||||    
Human   269 LIRQAKTPMTNSSIQFLDNAFRKRWQTLLS-VDDLVEKLVKRLEFTGELNNTYIFYTSDNG---- 328

  Fly   293 GMFSNTGSNFPLRGQKNTPWEGGVRVAGAIWSSGLQARGSIFRQPLYVA--DWLPTLSRAADIEL 355
               .:|| .|.|...|...:|..::|...:...|::...:   ..:.||  |..||:...|..:|
Human   329 ---YHTG-QFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQT---SKMLVANIDLGPTILDIAGYDL 386

  Fly   356 DSSLKLDGIDLWPELSGSADAPHVPREILHILDDVWRLSAL--QMGQWKYV-------------- 404
            :.: ::||:.|.|.|.|:::.             .||...|  ..|:.:.|              
Human   387 NKT-QMDGMSLLPILRGASNL-------------TWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQ 437

  Fly   405 -----------NGTTASGRYDSV---LTYRELDD 424
                       |.|.|..|..|.   |.|.|.||
Human   438 CFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDD 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_001287102.1 AslA 23..458 CDD:225661 109/487 (22%)
4-S 27..408 CDD:293753 98/462 (21%)
DUF4976 <478..540 CDD:303608
GNSNP_002067.1 G6S 46..495 CDD:293766 108/484 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.