DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and ARSK

DIOPT Version :9

Sequence 1:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_937793.1 Gene:ARSK / 153642 HGNCID:25239 Length:536 Species:Homo sapiens


Alignment Length:451 Identity:99/451 - (21%)
Similarity:155/451 - (34%) Gaps:120/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AARRPNIIIIMADDMGFDD-VSFRGGREFL-TPNIDALAYHGRLLDRLYAPA-MCTPSRGALLSG 84
            ||:.||::::::|  .||. ::|..|.:.: .|.|:.:...|......|..: :|.|||.|:.||
Human    28 AAKAPNVVLVVSD--SFDGRLTFHPGSQVVKLPFINFMKTRGTSFLNAYTNSPICCPSRAAMWSG 90

  Fly    85 RYPIHTGTQHFVISNEEPW----ALTLNATLMPEIFKEAGYSTNLVGKWHLGFSRPEYTPTRRGF 145
            .:...|          |.|    .|..|.|...::.:..||.|...||.       :||......
Human    91 LFTHLT----------ESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKL-------DYTSGHHSI 138

  Fly   146 DYHFGYWGAYIDYFQRRSKMPVANYSLGYDFRRNMELECRDRGVYVTDLLTAEAERLIKDHADKE 210
            ......|...:.:..|:...|:.|.     .|...::...:|....||   .....|.|:..:..
Human   139 SNRVEAWTRDVAFLLRQEGRPMVNL-----IRNRTKVRVMERDWQNTD---KAVNWLRKEAINYT 195

  Fly   211 QPLFLMLSHLAAHTANEDDPLQAPEEE--------------IQKFSY--IKDPN----------- 248
            :|..:.|.      .|...|..:|...              ::|.|:  ||.|.           
Human   196 EPFVIYLG------LNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVD 254

  Fly   249 ---------------------RRKYAAMISKLDQSVGRIITALSSTDQLENSIVIFYSDNG--AP 290
                                 |..|.||.::.|..:|.||.||...|.|:.:|||:.||:|  |.
Human   255 YYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAM 319

  Fly   291 SVGMFSNTGSNFPLRGQKNTPWEGGVRVAGAIWSSGLQARGSIFRQPLYVADWLPTLSRAADIEL 355
            ....|           .|.:.:|....|...:...|::| |......:.:.|..||:...|.|.|
Human   320 EHRQF-----------YKMSMYEASAHVPLLMMGPGIKA-GLQVSNVVSLVDIYPTMLDIAGIPL 372

  Fly   356 DSSLKLDGIDLWPELSGSADAPHVPREILHILDDVWRLS------------ALQMGQWKYV 404
            ..:  |.|..|.|..|.:....|..:.    |...|.||            .|:...|||:
Human   373 PQN--LSGYSLLPLSSETFKNEHKVKN----LHPPWILSEFHGCNVNASTYMLRTNHWKYI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_001287102.1 AslA 23..458 CDD:225661 99/451 (22%)
4-S 27..408 CDD:293753 97/447 (22%)
DUF4976 <478..540 CDD:303608
ARSKNP_937793.1 ARSK 32..447 CDD:293781 97/447 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.