DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32163 and AT1G77540

DIOPT Version :9

Sequence 1:NP_730181.1 Gene:CG32163 / 317891 FlyBaseID:FBgn0052163 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_565157.1 Gene:AT1G77540 / 844090 AraportID:AT1G77540 Length:114 Species:Arabidopsis thaliana


Alignment Length:84 Identity:25/84 - (29%)
Similarity:39/84 - (46%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVVRHKRGRFYTDIGELRAVLVYSIRDG--VMTINSTNVPEELGGHGIGKLLAKSALDYALLNGH 117
            ||....:.||.|:..|  |.:.|.:|:.  ||.:..|.||....|.|:...|..:|.::|..:..
plant    19 IVWNEGKRRFETEDHE--AFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSI 81

  Fly   118 FIIIRCRFVQHYIDKYEPQ 136
            .||..|.:|.   |.:.|:
plant    82 SIIPSCSYVS---DTFLPR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32163NP_730181.1 Acetyltransf_CG 63..138 CDD:291226 23/76 (30%)
AT1G77540NP_565157.1 Acetyltransf_CG 27..102 CDD:405264 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105380
Panther 1 1.100 - - LDO PTHR31435
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.