DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32163 and natd1

DIOPT Version :9

Sequence 1:NP_730181.1 Gene:CG32163 / 317891 FlyBaseID:FBgn0052163 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001008090.1 Gene:natd1 / 493452 XenbaseID:XB-GENE-6458151 Length:109 Species:Xenopus tropicalis


Alignment Length:92 Identity:31/92 - (33%)
Similarity:47/92 - (51%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVVRH--KRGRFYTDIGEL--RAVLVYS-IRDGVMTINSTNVPEELGGHGIGKLLAKSALDYAL- 113
            |.|.|  ||.:|...:...  ||||:|. :....:.:..|.||:...|.||.|.|||:|:|:.: 
 Frog    15 IRVEHDRKRRQFSVRLNGCHDRAVLLYEYVGKKTVDLQHTEVPDAFRGRGIAKHLAKAAMDFVVE 79

  Fly   114 --LNGHFIIIRCRFVQHYIDKYE-PQY 137
              |..|   :.|.::|.|:.:.. |||
 Frog    80 EDLKAH---LTCWYIQKYVKENPLPQY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32163NP_730181.1 Acetyltransf_CG 63..138 CDD:291226 26/82 (32%)
natd1NP_001008090.1 Acetyltransf_CG 25..99 CDD:379642 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.