powered by:
Protein Alignment CG32163 and ZK1098.11
DIOPT Version :9
Sequence 1: | NP_730181.1 |
Gene: | CG32163 / 317891 |
FlyBaseID: | FBgn0052163 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001022982.1 |
Gene: | ZK1098.11 / 3565174 |
WormBaseID: | WBGene00014226 |
Length: | 100 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 20/61 - (32%) |
Similarity: | 32/61 - (52%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 RAVLVYS-IRDGVMTINSTNVPEELGGHGIGKLLAKSALDYALLNGHFIIIRCRFVQHYID 131
:|.|.|: :.:.|:....|..||:..|.|:.|:|.|..|.||..|.:.:...|.:|..|:|
Worm 23 KAYLEYAELPNRVLDFQHTVTPEDQQGKGVAKILVKEGLKYAADNKYLVQPTCWYVAKYLD 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160158686 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105380 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31435 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.800 |
|
Return to query results.
Submit another query.