DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32163 and NATD1

DIOPT Version :9

Sequence 1:NP_730181.1 Gene:CG32163 / 317891 FlyBaseID:FBgn0052163 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_690878.2 Gene:NATD1 / 256302 HGNCID:30770 Length:113 Species:Homo sapiens


Alignment Length:95 Identity:33/95 - (34%)
Similarity:48/95 - (50%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GTHIVVRHKRGR--FYTDIGEL--RAVLVYS-IRDGVMTINSTNVPEELGGHGIGKLLAKSALDY 111
            |..|.|.|.|.|  |...:...  ||||:|. :...::.:..|.||:...|.||.|.|||:|||:
Human    16 GCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDF 80

  Fly   112 AL---LNGHFIIIRCRFVQHYIDKYE-PQY 137
            .:   |..|   :.|.::|.|:.:.. |||
Human    81 VVEEDLKAH---LTCWYIQKYVKENPLPQY 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32163NP_730181.1 Acetyltransf_CG 63..138 CDD:291226 28/84 (33%)
NATD1NP_690878.2 Acetyltransf_CG 29..103 CDD:405264 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105380
Panther 1 1.100 - - LDO PTHR31435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.