DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32163 and Natd1

DIOPT Version :9

Sequence 1:NP_730181.1 Gene:CG32163 / 317891 FlyBaseID:FBgn0052163 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_079570.1 Gene:Natd1 / 24083 MGIID:1344388 Length:110 Species:Mus musculus


Alignment Length:95 Identity:33/95 - (34%)
Similarity:48/95 - (50%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GTHIVVRHKRGR--FYTDIGEL--RAVLVYS-IRDGVMTINSTNVPEELGGHGIGKLLAKSALDY 111
            |..|.|.|.|.|  |...:...  ||||:|. :...::.:..|.||:...|.||.|.|||:|||:
Mouse    13 GGPIRVEHDRQRRQFSVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDF 77

  Fly   112 AL---LNGHFIIIRCRFVQHYIDKYE-PQY 137
            .:   |..|   :.|.::|.|:.:.. |||
Mouse    78 VVEEDLKAH---LTCWYIQKYVKENPLPQY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32163NP_730181.1 Acetyltransf_CG 63..138 CDD:291226 28/84 (33%)
Natd1NP_079570.1 Acetyltransf_CG 26..100 CDD:405264 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105380
Panther 1 1.100 - - LDO PTHR31435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.