DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32163 and natd1

DIOPT Version :9

Sequence 1:NP_730181.1 Gene:CG32163 / 317891 FlyBaseID:FBgn0052163 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001013336.1 Gene:natd1 / 100002945 ZFINID:ZDB-GENE-050306-19 Length:110 Species:Danio rerio


Alignment Length:100 Identity:31/100 - (31%)
Similarity:51/100 - (51%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 THIVVRH--KRGRFYTDI--GELRAVLVYS-IRDGVMTINSTNVPEELGGHGIGKLLAKSALDYA 112
            |.:.|.|  ||.:|...:  ...:|||:|. :....:.:..|.|||...|..|.|.|||:|:|:.
Zfish    14 TRLRVEHDKKRRQFSIRLNGSHDKAVLLYEYVGKKTVDLQHTEVPEAYRGREIAKHLAKAAMDFV 78

  Fly   113 L---LNGHFIIIRCRFVQHYI-DKYEPQYAKYILN 143
            :   |..|   :.|.::|.:: :...|||.:.||:
Zfish    79 VEEDLKAH---LTCWYIQKFVKENPHPQYLERILH 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32163NP_730181.1 Acetyltransf_CG 63..138 CDD:291226 23/81 (28%)
natd1NP_001013336.1 Acetyltransf_CG 26..104 CDD:291226 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105380
Panther 1 1.100 - - LDO PTHR31435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.