DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32161 and CG13725

DIOPT Version :9

Sequence 1:NP_730205.1 Gene:CG32161 / 317890 FlyBaseID:FBgn0052161 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648967.1 Gene:CG13725 / 39928 FlyBaseID:FBgn0036708 Length:199 Species:Drosophila melanogaster


Alignment Length:210 Identity:42/210 - (20%)
Similarity:89/210 - (42%) Gaps:48/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RMGHFNHCTLALATLDLVCIVCL--LHYQLARHGRDLFFWCEELDQRLVEYMLSAVVLMASVSVL 85
            |:...:|  ||:..:.::|::.|  :.|.:.    |||.|.|.:::..:...:...:....|:::
  Fly    13 RLIRLHH--LAVGNIAVLCLIVLSIMDYGIL----DLFCWFETVEEENIPLTVLMYIGGLKVAII 71

  Fly    86 GSCVDGFIFSAL--------VQRKMSRFDMPRQYFEDRYRRFVFMRLVRQLEQALKVQAKQSELG 142
                   :|.||        .:.:....|||..|...||.||:.|.|:..:::.:...:.     
  Fly    72 -------LFLALWCWTREEAEKNQEGNMDMPISYVRKRYCRFLVMNLLASVDRLIHHHSH----- 124

  Fly   143 ERMMTPLANLFEAQQLIKEAIDEFRTAVRVLLWPNRSDVLAEAFVLFH----ISESQLSDLTLQG 203
                  :.:..::::...||:::||...|.|.  .|:|:  :..|..|    :.:.|..:|...|
  Fly   125 ------IDDFLQSRKDCGEAVEQFRWRARRLF--ERTDL--QLCVPLHEVLSVDDPQEKELLRLG 179

  Fly   204 YRLNDVEGEDMSNSR 218
            |      |:.::..|
  Fly   180 Y------GDKLAQLR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32161NP_730205.1 DUF4736 42..224 CDD:292508 37/191 (19%)
CG13725NP_648967.1 DUF4736 35..199 CDD:292508 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.