DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32161 and CG6497

DIOPT Version :9

Sequence 1:NP_730205.1 Gene:CG32161 / 317890 FlyBaseID:FBgn0052161 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001261980.1 Gene:CG6497 / 39924 FlyBaseID:FBgn0036704 Length:218 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:99/218 - (45%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HFNHCTLALATLDLVCIVCLLHYQLARHGRDLFFW------------CEELDQRLVEYMLSAVVL 78
            |.|:..:||.:...|.:...||||.:.|..||.:|            |.:|...|:.:.::|:.:
  Fly    16 HANYPYIALYSGLGVAVTAYLHYQWSVHHYDLMYWKRLAEVFSQDIDCIQLAILLLIFAINAIFV 80

  Fly    79 MASVSV-LGSCVDGFIFSALVQRKMSRFDMPRQYFEDRYRRFVFMRLVRQLEQALKVQAKQSELG 142
            ...:|| |...:|.....:|::.|            |||.||:.:||:.:|:   ::|:|.|  .
  Fly    81 FIILSVYLRPALDNGSEMSLLEIK------------DRYARFILLRLIARLD---RIQSKIS--A 128

  Fly   143 ERMMTPLANLFEAQQLIKEAIDEFRTAVRVLLWPNRSDVLAEAFVLFHISESQLSDLTLQGY--- 204
            :|......:...|...:.:|:..||...|.|:.||.|::|.....::.:::.:...|...||   
  Fly   129 KRKSLTFQHYVRAHTNMVKAVAVFRKDARKLILPNESEILMPIEDIYGVADDEERLLRRSGYYKL 193

  Fly   205 --RLNDVEGEDMSNSRLSQMLNP 225
              ...|...:.:.|::|.::|.|
  Fly   194 IIDTTDETVKSLFNAKLEEILFP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32161NP_730205.1 DUF4736 42..224 CDD:292508 46/199 (23%)
CG6497NP_001261980.1 DUF4736 32..207 CDD:292508 44/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.