DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and OTU2

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_011850.1 Gene:OTU2 / 856373 SGDID:S000001005 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:18/76 - (23%)
Similarity:36/76 - (47%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 NKSSKWK--KNKLFEMDQYFEHSKCDLMPYMPVDNCYQGVHIQDDEQRDHNDP-EQNDQNPTTEQ 481
            |:...||  .|::|:.:|..|         :..:...:.:.|..||:...|.| :|..|..|.::
Yeast    63 NEIRDWKIANNEVFDAEQEDE---------VTPEKLLEQLSISRDEKEQQNVPVQQQQQGQTKKR 118

  Fly   482 RDREEPQAQKQ 492
            |:|::.:..|:
Yeast   119 RNRQKERLAKR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590
Tudor_TDRD13-like 336..389 CDD:410451
OTU2NP_011850.1 COG5539 1..306 CDD:227826 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.