DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT5G67170

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001318894.1 Gene:AT5G67170 / 836852 AraportID:AT5G67170 Length:375 Species:Arabidopsis thaliana


Alignment Length:138 Identity:37/138 - (26%)
Similarity:61/138 - (44%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGD--FDSYM 86
            |::.||.......|.:..||.||:|:...:..|.:.|...|.::...|.:||..|..|  |:.|.
plant    32 LDALGLKIIQVTADGNCFFRAIADQLEGNEDEHNKYRNMIVLYIVKNREMFEPFIEDDVPFEDYC 96

  Fly    87 QDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVFNRRYAENF--------RVFFNNENH 143
            :.|....|:....||:|.|.:.|.|:.::.  ||..     |.|..||        .:.:::..|
plant    97 KTMDDDGTWAGNMELQAASLVTRSNICIHR--NMSP-----RWYIRNFEDTRTRMIHLSYHDGEH 154

  Fly   144 FDSVYDVE 151
            ::||...|
plant   155 YNSVRSKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 24/79 (30%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
AT5G67170NP_001318894.1 OTU 43..155 CDD:418725 30/118 (25%)
secA <247..331 CDD:237255
SWIM_PBPRA1643 <296..330 CDD:200353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.