DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT3G22260

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001189948.1 Gene:AT3G22260 / 821796 AraportID:AT3G22260 Length:245 Species:Arabidopsis thaliana


Alignment Length:148 Identity:31/148 - (20%)
Similarity:65/148 - (43%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRQAPDPYDQYLE---------SRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMT 68
            :|:.||..|..|:         :.||.......|.:..||.:|:|::.....|..:|...|:.:.
plant    76 NREIPDINDATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLK 140

  Fly    69 LKRRIFEKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVF---NRRY 130
            .:|:::|:.:|..:..|.:.|.|...:|....|:|.:..:...:.|...:...:.:..   |:..
plant   141 QQRKLYEEYVPMKYRHYTRKMKKHGEWGDHVTLQAAADRFEAKICLVTSFRDQSYIEILPHNKNP 205

  Fly   131 AENFRVFFNNENHFDSVY 148
            .....:.|.:|.|::|:|
plant   206 LREAWLSFWSEVHYNSLY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 17/77 (22%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
AT3G22260NP_001189948.1 OTU 108..>192 CDD:418725 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.