DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT2G39320

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_181464.1 Gene:AT2G39320 / 818517 AraportID:AT2G39320 Length:189 Species:Arabidopsis thaliana


Alignment Length:155 Identity:31/155 - (20%)
Similarity:53/155 - (34%) Gaps:56/155 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYMQDM--SKPKTYGTMT 99
            |.:..||.:|:|:|.....|..:|.|.|:                     |:|  |....:|...
plant     5 DGNCQFRALADQLYQNSDCHELVRQEIVK---------------------QNMSLSTNSQWGDEV 48

  Fly   100 ELRAMSCLYRRNVILYEPYNMGTSV------------------VFNRRYAENFRVFFNNENHFDS 146
            .||..:.:|:..:||.      ||:                  |.:..|....        ||:|
plant    49 TLRVAADVYQVKIILI------TSIKLIPFMEFLPKSQKEPDKVIHMSYLAGI--------HFNS 99

  Fly   147 VYDVEYIERAAICQSIAFKLLYQKL 171
            :|. :..|:.:...|.:...::.||
plant   100 IYK-KNKEKGSRSSSSSSSAVWMKL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 18/79 (23%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
AT2G39320NP_181464.1 OTU 3..>66 CDD:388712 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.