DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and OTLD1

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001189616.1 Gene:OTLD1 / 817278 AraportID:AT2G27350 Length:506 Species:Arabidopsis thaliana


Alignment Length:322 Identity:65/322 - (20%)
Similarity:126/322 - (39%) Gaps:52/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYMQDMS 90
            |:|...:....|.:.|||.:|:|:|.....:...|..|:.:|..:|..|.:.|...|.||::...
plant   213 SKGFEIRRMLEDGNCLFRAVADQVYGDSEAYDLARQMCMDYMEQERDHFSQFITEGFTSYLKRKR 277

  Fly    91 KPKTYGTMTELRAMSCLYRRNVILY----EPYNMGTSVVFNRRYAEN---FRVFFNNENHFDSVY 148
            :.|.||...|::|::.:|.|.:.:|    ||.|     :|...|:.:   .|:.:::.||::|:.
plant   278 RDKVYGNNVEIQALAEMYNRPIHIYSYSTEPIN-----IFQGNYSTDTPPIRLSYHHGNHYNSLV 337

  Fly   149 DVEYIERAAICQSIAFKLLYQKLFKLPDVSFAVEIMLHPHTFNWDRFNVEFDDKGYMVRIHCTDG 213
            |.   .|..:...:.|..|..:......|..|::.. ..|..:    |....:..:...:..|:.
plant   338 DP---HRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQ-QEHQID----NALLAEGRFYSDLELTEK 394

  Fly   214 RVFKLDLPGDTNCILENYKLCNFHSTNGNQSINARKGGRLEIKNQEERKASGSSGHEPNDLLPMC 278
            .:.:..:.......|..:.             ..|.|.:....:..|..:||::|...:|..|..
plant   395 EIERSVMEASRAEYLMEWS-------------KPRIGPKESSTSNAETSSSGATGPSGSDSKPAE 446

  Fly   279 PNR----LESCVRQLLDDGISPFPYKVAKSMDPYMYRN----------IEFDCWNDMRKEAK 326
            ..:    |.|.:..:|..|.|     .|::|:.|....          :|..|..:.|::.|
plant   447 AVKEKTVLSSSIEMVLSMGFS-----YAQAMEAYSIFGDDVDSMVCYVLETSCGGNNRRKGK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 23/77 (30%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
OTLD1NP_001189616.1 OTU 224..333 CDD:303090 31/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.