DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud3

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001364018.1 Gene:Otud3 / 73162 MGIID:1920412 Length:443 Species:Mus musculus


Alignment Length:397 Identity:82/397 - (20%)
Similarity:132/397 - (33%) Gaps:137/397 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRPITSGSRQAPDP-----------YDQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEI 59
            :|.:....|..|||           :...|::.||..:....|.:.|||.:.:|:......|.:.
Mouse    30 RRALAKERRNRPDPGGSGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKH 94

  Fly    60 RLECVRFMTLKRRIFEKEIPGD--FDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILYEPYN--- 119
            |.|.|.:|..:|..||..:..|  |:.::..:|||.|:.....:.|.:..::.||:::: .|   
Mouse    95 RQETVDYMIRQREDFEPFVEDDIPFEKHVASLSKPGTFAGNDAIVAFARNHQLNVVIHQ-LNAPL 158

  Fly   120 ---MGTSVVFNR------RYAENF----RVFFNNENHFDSVYDVEYIE----------RAAICQS 161
               .||.....|      ||.|::    |:..|:|.....:.||...:          .|.:|..
Mouse   159 WQIRGTDKGSTRELHIAYRYGEHYDSVRRINDNSEAPAHLLTDVSEAQLLLLSGLQETGAELCPQ 223

  Fly   162 IAFKLLYQKLFKLP-------DVSFAVEI-MLHPHTFNWDRFNVEFDDKGYMVR----------I 208
            ::..   ..|..||       .::.||:. |||....|...   :...||..|:          :
Mouse   224 LSPS---GPLLSLPLREPAIQSIAKAVQFQMLHQDGANKKE---KMKTKGVDVKDGLRDDVEDAV 282

  Fly   209 H-------CTDGRVFKLDLPGDTNCILENYKLCNFH----------------------------- 237
            |       ||           |.|.|::|.:..|::                             
Mouse   283 HKVGSATGCT-----------DFNLIVQNLEAENYNIKSAITALLQVNQGTGNDAEENHEPGDRV 336

  Fly   238 --------------STNGNQSINARKGGRLEIKNQEERKASGSSGHEPNDLLPMCPN-------R 281
                          ..:|||   .|..||:|........|..|..|:..  ||...|       |
Mouse   337 KQRGPSREEAGSGRRLSGNQ---GRNEGRMETSEARASPAEESKAHKSQ--LPKVTNKQRREQQR 396

  Fly   282 LESCVRQ 288
            ||...||
Mouse   397 LEKKKRQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 22/79 (28%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud3NP_001364018.1 OTU 70..182 CDD:388712 29/112 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.