DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud1

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_081991.1 Gene:Otud1 / 71198 MGIID:1918448 Length:454 Species:Mus musculus


Alignment Length:140 Identity:34/140 - (24%)
Similarity:62/140 - (44%) Gaps:8/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSY 85
            |:||..|..||.|...|.:.|:|.:::.:|..|.||.|:|.:.|.::......|...|.||...:
Mouse   274 DKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEF 338

  Fly    86 MQDMSKPKTYGTMTELRAMSCLYRRNVIL-----YEPYNMGTSVVF---NRRYAENFRVFFNNEN 142
            :...::...:....||.||..:...|:.|     .|...:.|.:.:   ......:..:.:.:..
Mouse   339 IIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNG 403

  Fly   143 HFDSVYDVEY 152
            |:|:|:|..|
Mouse   404 HYDAVFDHSY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 20/82 (24%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud1NP_081991.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..64
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..257
Cys-loop. /evidence=ECO:0000250 287..293 1/5 (20%)
OTU 288..405 CDD:280496 22/116 (19%)
His-loop. /evidence=ECO:0000250 342..352 0/9 (0%)
Variable-loop. /evidence=ECO:0000250 399..404 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.